SCOPe 2.08: Domain d4xwgl1: 4xwg L:1-108

Lineage for d4xwgl1 (4xwg L:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4xwgl1: 4xwg L:1-108 [275508]
   Other proteins in same PDB: d4xwgh_, d4xwgl2
   automated match to d1lila1
   complexed with nag, zn

Details for d4xwgl1

PDB Entry: 4xwg, 2.65 Å

PDB Description: crystal structure of lcat (c31y) in complex with fab1

PDB Compounds: (L:) Fab1 Light Chain

SCOPe Domain Sequences for d4xwgl1:

Sequence; same for both SEQRES and ATOM records:

>d4xwgl1 b.1.1.0 (L:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syeltqppsvsvspgqtasitcsgdklgnkftswyqrkpgqspvlviyqdtkrpsgiper
fsgstsgntatltisgtqamdeadyycqawdsstawvfgggtklevlg

Timeline for d4xwgl1:

• d4xwgl1 first appeared in SCOPe 2.05
  
• d4xwgl1 appears in SCOPe 2.07