SCOPe 2.06: Domain d4xz5b_: 4xz5 B:

Lineage for d4xz5b_ (4xz5 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.0: automated matches [191576] (1 protein)
   not a true family

6. Protein automated matches [191011] (13 species)
   not a true protein

7. Species Thiomicrospira crunogena [TaxId:317025] [275505] (1 PDB entry)

8. Domain d4xz5b_: 4xz5 B: [275506]
   automated match to d3iaib_
   complexed with bct, zn

Details for d4xz5b_

PDB Entry: 4xz5, 2.6 Å

PDB Description: structure of the thermostable alpha-carbonic anydrase from thiomicrospira crunogena xcl-2 gammaproteobacterium

PDB Compounds: (B:) Carbonic anhydrase, alpha family

SCOPe Domain Sequences for d4xz5b_:

Sequence; same for both SEQRES and ATOM records:

>d4xz5b_ b.74.1.0 (B:) automated matches {Thiomicrospira crunogena [TaxId: 317025]}
pphwgyfgeegpqywgelapefstcktgknqspinlkpqtavgttslpgfdvyyretalk
linnghtlqvniplgsyikinghryellqyhfhtpsehqrdgfnypmemhlvhkdgdgnl
aviailfqegeenetlaklmsflpqtlkkqeihesvkihpakffpadkkfykysgslttp
pcsegvywmvfkqpiqasvtqlekmheylgsnarpvqrqnartllkswpd

Timeline for d4xz5b_:

• d4xz5b_ first appeared in SCOPe 2.05
  
• d4xz5b_ appears in SCOPe 2.07
  
• d4xz5b_ appears in the current release, SCOPe 2.08