Class b: All beta proteins [48724] (178 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
Protein Adenovirus fiber protein "knob" domain [49837] (18 species) |
Species Human adenovirus 37 [TaxId:52275] [110136] (11 PDB entries) Uniprot Q64823 182-365 ! Uniprot Q64823 181-365 |
Domain d4xqbc_: 4xqb C: [275504] automated match to d1uxaa_ complexed with 425, act, zn |
PDB Entry: 4xqb (more details), 1.6 Å
SCOPe Domain Sequences for d4xqbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xqbc_ b.21.1.1 (C:) Adenovirus fiber protein "knob" domain {Human adenovirus 37 [TaxId: 52275]} dtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpki ksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskk yardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsy iaqe
Timeline for d4xqbc_: