Lineage for d4xqbc_ (4xqb C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386499Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2386500Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2386501Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2386502Protein Adenovirus fiber protein "knob" domain [49837] (18 species)
  7. 2386527Species Human adenovirus 37 [TaxId:52275] [110136] (11 PDB entries)
    Uniprot Q64823 182-365 ! Uniprot Q64823 181-365
  8. 2386548Domain d4xqbc_: 4xqb C: [275504]
    automated match to d1uxaa_
    complexed with 425, act, zn

Details for d4xqbc_

PDB Entry: 4xqb (more details), 1.6 Å

PDB Description: crystal structure of ad37 fiber knob in complex with trivalent sialic acid inhibitor me0461
PDB Compounds: (C:) Fiber

SCOPe Domain Sequences for d4xqbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xqbc_ b.21.1.1 (C:) Adenovirus fiber protein "knob" domain {Human adenovirus 37 [TaxId: 52275]}
dtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpki
ksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskk
yardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsy
iaqe

SCOPe Domain Coordinates for d4xqbc_:

Click to download the PDB-style file with coordinates for d4xqbc_.
(The format of our PDB-style files is described here.)

Timeline for d4xqbc_: