Lineage for d4xqac_ (4xqa C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2776829Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2776830Protein Adenovirus fiber protein 'knob' domain [49837] (18 species)
  7. 2776855Species Human adenovirus 37 [TaxId:52275] [110136] (11 PDB entries)
    Uniprot Q64823 182-365 ! Uniprot Q64823 181-365
  8. 2776867Domain d4xqac_: 4xqa C: [275501]
    automated match to d1uxaa_
    complexed with 423, act, zn

Details for d4xqac_

PDB Entry: 4xqa (more details), 1.41 Å

PDB Description: crystal structure of ad37 fiber knob in complex with trivalent sialic acid inhibitor me0462
PDB Compounds: (C:) Fiber

SCOPe Domain Sequences for d4xqac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xqac_ b.21.1.1 (C:) Adenovirus fiber protein 'knob' domain {Human adenovirus 37 [TaxId: 52275]}
trtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkik
sftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskky
ardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyi
aqe

SCOPe Domain Coordinates for d4xqac_:

Click to download the PDB-style file with coordinates for d4xqac_.
(The format of our PDB-style files is described here.)

Timeline for d4xqac_: