SCOPe 2.07: Domain d2qwha_: 2qwh A:

Lineage for d2qwha_ (2qwh A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)

6. Protein Influenza neuraminidase [50943] (8 species)

7. Species Influenza A virus, different strains [TaxId:11320] [50944] (89 PDB entries)
   Uniprot P03472 84-470

8. Domain d2qwha_: 2qwh A: [27550]
   complexed with ca, g39, nag

Details for d2qwha_

PDB Entry: 2qwh, 1.8 Å

PDB Description: the x-ray structure of a complex of 5-n-acetyl-5-amino-3-(1- ethylpropoxy)-1-cyclohexene-1-carboxylic acid (gs4071) and a drug resistant variant r292k of tern n9 influenza virus neuraminidase

PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d2qwha_:

Sequence; same for both SEQRES and ATOM records:

>d2qwha_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
kilkweplagtakhieecscygeraeitctckdnwqgsnrpviridpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwdwpdgakieyfl

Timeline for d2qwha_:

• d2qwha_ first appeared (with stable ids) in SCOP 1.55, called d2qwh__
  
• d2qwha_ appears in SCOPe 2.06
  
• d2qwha_ appears in the current release, SCOPe 2.08