SCOPe 2.07: Domain d4xqaa_: 4xqa A:

Lineage for d4xqaa_ (4xqa A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein Adenovirus fiber protein "knob" domain [49837] (18 species)

7. Species Human adenovirus 37 [TaxId:52275] [110136] (11 PDB entries)
   Uniprot Q64823 182-365 ! Uniprot Q64823 181-365

8. Domain d4xqaa_: 4xqa A: [275499]
   automated match to d1uxaa_
   complexed with 423, act, zn

Details for d4xqaa_

PDB Entry: 4xqa, 1.41 Å

PDB Description: crystal structure of ad37 fiber knob in complex with trivalent sialic acid inhibitor me0462

PDB Compounds: (A:) Fiber

SCOPe Domain Sequences for d4xqaa_:

Sequence; same for both SEQRES and ATOM records:

>d4xqaa_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus 37 [TaxId: 52275]}
dtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpki
ksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskk
yardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsy
iaqe

Timeline for d4xqaa_:

• d4xqaa_ first appeared in SCOPe 2.05
  
• d4xqaa_ appears in SCOPe 2.06
  
• d4xqaa_ appears in the current release, SCOPe 2.08