SCOPe 2.05: Domain d4xmea_: 4xme A:

Lineage for d4xmea_ (4xme A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (16 species)
   not a true protein

7. Species Rhodnius prolixus [TaxId:13249] [193297] (8 PDB entries)

8. Domain d4xmea_: 4xme A: [275498]
   automated match to d1np1a_
   complexed with gol, hem, no

Details for d4xmea_

PDB Entry: 4xme, 1.29 Å

PDB Description: crystal structure of nitrophorin 7 from rhodnius prolixus at ph 7.8 complexed with no

PDB Compounds: (A:) Nitrophorin-7

SCOPe Domain Sequences for d4xmea_:

Sequence; same for both SEQRES and ATOM records:

>d4xmea_ b.60.1.0 (A:) automated matches {Rhodnius prolixus [TaxId: 13249]}
pgecsvnvipkknldkakffsgtwyethyldmdpqatekfcfsfapresggtvkealyhf
nvdskvsfyntgtgplesngakytakfntvdkkgkeikpadekysytvtvieaakqsali
hiclqedgkdigdlysvlnrnknalpnkkikkalnkvslvltkfvvtkdldckyddkfls
swqk

Timeline for d4xmea_:

• d4xmea_ is new in SCOPe 2.05-stable
  
• d4xmea_ appears in SCOPe 2.06
  
• d4xmea_ appears in the current release, SCOPe 2.08