Lineage for d4xmca_ (4xmc A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2073091Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2073092Protein automated matches [190698] (21 species)
    not a true protein
  7. 2073197Species Rhodnius prolixus [TaxId:13249] [193297] (10 PDB entries)
  8. 2073199Domain d4xmca_: 4xmc A: [275495]
    automated match to d1np1a_
    complexed with hem

Details for d4xmca_

PDB Entry: 4xmc (more details), 1.42 Å

PDB Description: crystal structure of nitrophorin 7 from rhodnius prolixus at ph 5.8
PDB Compounds: (A:) Nitrophorin-7

SCOPe Domain Sequences for d4xmca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xmca_ b.60.1.0 (A:) automated matches {Rhodnius prolixus [TaxId: 13249]}
pgecsvnvipkknldkakffsgtwyethyldmdpqatekfcfsfapresggtvkealyhf
nvdskvsfyntgtgplesngakytakfntvdkkgkeikpadekysytvtvieaakqsali
hiclqedgkdigdlysvlnrnknalpnkkikkalnkvslvltkfvvtkdldckyddkfls
swqk

SCOPe Domain Coordinates for d4xmca_:

Click to download the PDB-style file with coordinates for d4xmca_.
(The format of our PDB-style files is described here.)

Timeline for d4xmca_: