Class b: All beta proteins [48724] (176 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
Protein automated matches [190698] (16 species) not a true protein |
Species Rhodnius prolixus [TaxId:13249] [193297] (8 PDB entries) |
Domain d4xmca_: 4xmc A: [275495] automated match to d1np1a_ complexed with hem |
PDB Entry: 4xmc (more details), 1.42 Å
SCOPe Domain Sequences for d4xmca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xmca_ b.60.1.0 (A:) automated matches {Rhodnius prolixus [TaxId: 13249]} pgecsvnvipkknldkakffsgtwyethyldmdpqatekfcfsfapresggtvkealyhf nvdskvsfyntgtgplesngakytakfntvdkkgkeikpadekysytvtvieaakqsali hiclqedgkdigdlysvlnrnknalpnkkikkalnkvslvltkfvvtkdldckyddkfls swqk
Timeline for d4xmca_: