Lineage for d3wxba_ (3wxb A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831204Species Gallus gallus [TaxId:9031] [275480] (1 PDB entry)
  8. 1831205Domain d3wxba_: 3wxb A: [275482]
    automated match to d1snya_
    complexed with edo, ndp

Details for d3wxba_

PDB Entry: 3wxb (more details), 1.98 Å

PDB Description: crystal structure of nadph bound carbonyl reductase from chicken fatty liver
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d3wxba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wxba_ c.2.1.0 (A:) automated matches {Gallus gallus [TaxId: 9031]}
ssglvprgshmgelrvrsvlvtganrgiglgfvqhllalsnppewvfatcrdpkgqraqe
lqklaskhpnlvivplevtdpasikaaaasvgerlkgsglnllinnagiarantidnetl
kdmsevyttntiaplllsqaflpmlkkaaqenpgsglscskaaiinisstagsiqdlylw
qygqalsyrcskaalnmltrcqsmgyrehgifcvalhpgwvktdmggtledksrvtvdes
vggmlkvlsnlsekdsgaflnwegkvmaw

SCOPe Domain Coordinates for d3wxba_:

Click to download the PDB-style file with coordinates for d3wxba_.
(The format of our PDB-style files is described here.)

Timeline for d3wxba_: