Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [275480] (1 PDB entry) |
Domain d3wxbb_: 3wxb B: [275481] Other proteins in same PDB: d3wxba2 automated match to d1snya_ complexed with edo, ndp |
PDB Entry: 3wxb (more details), 1.98 Å
SCOPe Domain Sequences for d3wxbb_:
Sequence, based on SEQRES records: (download)
>d3wxbb_ c.2.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} lrvrsvlvtganrgiglgfvqhllalsnppewvfatcrdpkgqraqelqklaskhpnlvi vplevtdpasikaaaasvgerlkgsglnllinnagiarantidnetlkdmsevyttntia plllsqaflpmlkkaaqenpgsglscskaaiinisstagsiqdlylwqygqalsyrcska alnmltrcqsmgyrehgifcvalhpgwvktdmggtledksrvtvdesvggmlkvlsnlse kdsgaflnwegkvmaw
>d3wxbb_ c.2.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} lrvrsvlvtganrgiglgfvqhllalsnppewvfatcrdpkgqraqelqklaskhpnlvi vplevtdpasikaaaasvgerlkgsglnllinnagiarantidnetlkdmsevyttntia plllsqaflpmlkkaaqeglscskaaiinisstagsiqdlylwqygqalsyrcskaalnm ltrcqsmgyrehgifcvalhpgwvktdmggtledksrvtvdesvggmlkvlsnlsekdsg aflnwegkvmaw
Timeline for d3wxbb_: