Lineage for d3wxbb_ (3wxb B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094689Species Chicken (Gallus gallus) [TaxId:9031] [275480] (1 PDB entry)
  8. 2094691Domain d3wxbb_: 3wxb B: [275481]
    Other proteins in same PDB: d3wxba2
    automated match to d1snya_
    complexed with edo, ndp

Details for d3wxbb_

PDB Entry: 3wxb (more details), 1.98 Å

PDB Description: crystal structure of nadph bound carbonyl reductase from chicken fatty liver
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d3wxbb_:

Sequence, based on SEQRES records: (download)

>d3wxbb_ c.2.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lrvrsvlvtganrgiglgfvqhllalsnppewvfatcrdpkgqraqelqklaskhpnlvi
vplevtdpasikaaaasvgerlkgsglnllinnagiarantidnetlkdmsevyttntia
plllsqaflpmlkkaaqenpgsglscskaaiinisstagsiqdlylwqygqalsyrcska
alnmltrcqsmgyrehgifcvalhpgwvktdmggtledksrvtvdesvggmlkvlsnlse
kdsgaflnwegkvmaw

Sequence, based on observed residues (ATOM records): (download)

>d3wxbb_ c.2.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lrvrsvlvtganrgiglgfvqhllalsnppewvfatcrdpkgqraqelqklaskhpnlvi
vplevtdpasikaaaasvgerlkgsglnllinnagiarantidnetlkdmsevyttntia
plllsqaflpmlkkaaqeglscskaaiinisstagsiqdlylwqygqalsyrcskaalnm
ltrcqsmgyrehgifcvalhpgwvktdmggtledksrvtvdesvggmlkvlsnlsekdsg
aflnwegkvmaw

SCOPe Domain Coordinates for d3wxbb_:

Click to download the PDB-style file with coordinates for d3wxbb_.
(The format of our PDB-style files is described here.)

Timeline for d3wxbb_: