| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
| Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins) automatically mapped to Pfam PF00891 |
| Protein Carminomycin 4-O-methyltransferase [110660] (1 species) |
| Species Streptomyces peucetius [TaxId:1950] [110661] (6 PDB entries) Uniprot Q06528 |
| Domain d4wxha2: 4wxh A:99-352 [275477] Other proteins in same PDB: d4wxha1, d4wxhb1 automated match to d1tw2b2 complexed with 3vl, dtu, sah, so4 |
PDB Entry: 4wxh (more details), 1.9 Å
SCOPe Domain Sequences for d4wxha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wxha2 c.66.1.12 (A:99-352) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}
paaqrawhdltqavaradisftrlpdairtgrptyesiygkpfyedlagrpdlrasfdsl
lacdqdvafdapaaaydwtnvrhvldvgggkggfaaaiarraphvsatvlemagtvdtar
sylkdeglsdrvdvvegdffeplprkadaiilsfvllnwpdhdavriltrcaealepggr
iliherddlhensfneqfsteldlrmlvflggalrtrekwdglaasaglvveevrqlpsp
tipydlsllvlapa
Timeline for d4wxha2: