SCOPe 2.05: Domain d4wxha1: 4wxh A:9-98

Lineage for d4wxha1 (4wxh A:9-98)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins)
   unknown function

6. Protein Carminomycin 4-O-methyltransferase [109667] (1 species)

7. Species Streptomyces peucetius [TaxId:1950] [109668] (3 PDB entries)
   Uniprot Q06528

8. Domain d4wxha1: 4wxh A:9-98 [275476]
   Other proteins in same PDB: d4wxha2, d4wxhb2
   automated match to d1tw2b1
   complexed with 3vl, dtu, sah, so4

Details for d4wxha1

PDB Entry: 4wxh, 1.9 Å

PDB Description: carminomycin-4-o-methyltransferase (dnrk) variant (298ser insert) in complex with s-adenosyl-l-homocysteine (sah) and aclacinomycin t

PDB Compounds: (A:) Carminomycin 4-O-methyltransferase DnrK

SCOPe Domain Sequences for d4wxha1:

Sequence; same for both SEQRES and ATOM records:

>d4wxha1 a.4.5.29 (A:9-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}
rpqqidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrli
rhlvaiglleedapgefvptevgelladdh

Timeline for d4wxha1:

• d4wxha1 is new in SCOPe 2.05-stable
  
• d4wxha1 appears in SCOPe 2.06
  
• d4wxha1 appears in the current release, SCOPe 2.08