Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins) unknown function |
Protein Carminomycin 4-O-methyltransferase [109667] (1 species) |
Species Streptomyces peucetius [TaxId:1950] [109668] (3 PDB entries) Uniprot Q06528 |
Domain d4wxha1: 4wxh A:9-98 [275476] Other proteins in same PDB: d4wxha2, d4wxhb2 automated match to d1tw2b1 complexed with 3vl, dtu, sah, so4 |
PDB Entry: 4wxh (more details), 1.9 Å
SCOPe Domain Sequences for d4wxha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wxha1 a.4.5.29 (A:9-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} rpqqidalrtlirlgslhtpmvvrtaatlrlvdhilagartvkalaartdtrpeallrli rhlvaiglleedapgefvptevgelladdh
Timeline for d4wxha1: