Lineage for d4wh0g_ (4wh0 G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864175Family c.33.1.3: Isochorismatase-like hydrolases [100948] (7 proteins)
  6. 2864208Protein automated matches [275457] (2 species)
    not a true protein
  7. 2864209Species Pseudomonas aeruginosa [TaxId:287] [275466] (1 PDB entry)
  8. 2864216Domain d4wh0g_: 4wh0 G: [275474]
    automated match to d1yaca_
    complexed with cl

Details for d4wh0g_

PDB Entry: 4wh0 (more details), 2.56 Å

PDB Description: ycac from pseudomonas aeruginosa with s-mercaptocysteine active site cysteine
PDB Compounds: (G:) Putative hydrolase

SCOPe Domain Sequences for d4wh0g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wh0g_ c.33.1.3 (G:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
sftykrldkndaavlfvdhqagllslvrdfspdefknnvlaladiarffnlptilttsfe
dgpngplvpelkemfpqapyiarpgninawdnedfvkavkatgkkqliiagvvtdvcvaf
ptlsaleegfdvfvvtdasgtfnpvvrdaawarmtaagaqlmnwfsvgcelhrdwrndie
gfgailgghlpayanliqsfgt

SCOPe Domain Coordinates for d4wh0g_:

Click to download the PDB-style file with coordinates for d4wh0g_.
(The format of our PDB-style files is described here.)

Timeline for d4wh0g_: