SCOP 1.73: Domain d2qwca_: 2qwc A:

Lineage for d2qwca_ (2qwc A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (2 families)

5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)

6. Protein Influenza neuraminidase [50943] (2 species)

7. Species Influenza A virus, different strains [TaxId:11320] [50944] (52 PDB entries)

8. Domain d2qwca_: 2qwc A: [27547]
   complexed with ca, dan, man, nag; mutant

Details for d2qwca_

PDB Entry: 2qwc, 1.6 Å

PDB Description: the x-ray structure of a complex of neu5ac2en and a drug resistant variant r292k of tern n9 influenza virus neuraminidase

PDB Compounds: (A:) Neuraminidase

SCOP Domain Sequences for d2qwca_:

Sequence; same for both SEQRES and ATOM records:

>d2qwca_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
kilkweplagtakhieecscygeraeitctckdnwqgsnrpviridpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwdwpdgakieyfl

Timeline for d2qwca_:

• d2qwca_ first appeared (with stable ids) in SCOP 1.55, called d2qwc__
  
• d2qwca_ was called d2qwc__ in SCOP 1.71
  
• d2qwca_ appears in SCOP 1.75
  
• d2qwca_ appears in the current release, SCOPe 2.08