Lineage for d4wgfb_ (4wgf B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864175Family c.33.1.3: Isochorismatase-like hydrolases [100948] (7 proteins)
  6. 2864208Protein automated matches [275457] (2 species)
    not a true protein
  7. 2864218Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [275458] (1 PDB entry)
  8. 2864220Domain d4wgfb_: 4wgf B: [275462]
    automated match to d1yaca_
    complexed with cl, hx2, rop, so4

Details for d4wgfb_

PDB Entry: 4wgf (more details), 2.34 Å

PDB Description: ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide
PDB Compounds: (B:) Probable hydrolase

SCOPe Domain Sequences for d4wgfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wgfb_ c.33.1.3 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
sftykrldkndaavlfvdhqagllslvrdfspdefknnvlaladiarffnlptilttsfe
dgpngplvpelkemfpqapyiarpgninawdnedfvkavkatgkkqliiagvvtdvcvaf
ptlsaleegfdvfvvtdasgtfnpvvrdaawarmtaagaqlmnwfsvgcelhrdwrndie
gfgailgghlpayanliqsfgt

SCOPe Domain Coordinates for d4wgfb_:

Click to download the PDB-style file with coordinates for d4wgfb_.
(The format of our PDB-style files is described here.)

Timeline for d4wgfb_: