Lineage for d1dil__ (1dil -)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379505Fold b.68: 6-bladed beta-propeller [50938] (10 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 379506Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 379507Family b.68.1.1: Sialidases (neuraminidases) [50940] (8 proteins)
  6. 379617Protein Salmonella sialidase [50941] (1 species)
  7. 379618Species Salmonella typhimurium, strain lt2 [TaxId:90371] [50942] (5 PDB entries)
  8. 379623Domain d1dil__: 1dil - [27546]
    complexed with axp, eqp, k

Details for d1dil__

PDB Entry: 1dil (more details), 1.9 Å

PDB Description: sialidase from salmonella typhimurium complexed with apana and epana inhibitors

SCOP Domain Sequences for d1dil__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dil__ b.68.1.1 (-) Salmonella sialidase {Salmonella typhimurium, strain lt2}
tveksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntas
dqsfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkw
nnndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsg
lqlndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnasl
vnnirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaq
nknndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvye
angsiefqdlsrhlpviksyn

SCOP Domain Coordinates for d1dil__:

Click to download the PDB-style file with coordinates for d1dil__.
(The format of our PDB-style files is described here.)

Timeline for d1dil__: