Lineage for d4wgfa_ (4wgf A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843896Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1843897Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 1843898Family c.33.1.3: Isochorismatase-like hydrolases [100948] (7 proteins)
  6. 1843931Protein automated matches [275457] (2 species)
    not a true protein
  7. 1843932Species Pseudomonas aeruginosa [TaxId:208964] [275458] (1 PDB entry)
  8. 1843933Domain d4wgfa_: 4wgf A: [275459]
    automated match to d1yaca_
    complexed with cl, hx2, rop, so4

Details for d4wgfa_

PDB Entry: 4wgf (more details), 2.34 Å

PDB Description: ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide
PDB Compounds: (A:) Probable hydrolase

SCOPe Domain Sequences for d4wgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wgfa_ c.33.1.3 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
sftykrldkndaavlfvdhqagllslvrdfspdefknnvlaladiarffnlptilttsfe
dgpngplvpelkemfpqapyiarpgninawdnedfvkavkatgkkqliiagvvtdvcvaf
ptlsaleegfdvfvvtdasgtfnpvvrdaawarmtaagaqlmnwfsvgcelhrdwrndie
gfgailgghlpayanliqsfgt

SCOPe Domain Coordinates for d4wgfa_:

Click to download the PDB-style file with coordinates for d4wgfa_.
(The format of our PDB-style files is described here.)

Timeline for d4wgfa_: