Lineage for d4u3ka1 (4u3k A:19-218)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006251Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2006252Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2006284Family a.116.1.0: automated matches [227202] (1 protein)
    not a true family
  6. 2006285Protein automated matches [226932] (3 species)
    not a true protein
  7. 2006286Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [275444] (1 PDB entry)
  8. 2006287Domain d4u3ka1: 4u3k A:19-218 [275445]
    Other proteins in same PDB: d4u3ka2
    automated match to d2osaa_

Details for d4u3ka1

PDB Entry: 4u3k (more details), 2.19 Å

PDB Description: crystal structure of the rhogap domain of rgd1p at 2.19 angstroms resolution
PDB Compounds: (A:) RHO GTPase-activating protein RGD1

SCOPe Domain Sequences for d4u3ka1:

Sequence, based on SEQRES records: (download)

>d4u3ka1 a.116.1.0 (A:19-218) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
fktfgvplesliefeqdmvpaivrqciyvidkfgldqegiyrksanvldvsklkeeidkd
panismilpskphsdsdiylvgsllktffaslpdsvlpkalsseikvclqiedpttrknf
mhgliynlpdaqywtlralvfhlkrvlaheaqnrmnlralciiwgptiapanpddandvn
fqimamevllevsdqafepe

Sequence, based on observed residues (ATOM records): (download)

>d4u3ka1 a.116.1.0 (A:19-218) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
fktfgvplesliefqdmvpaivrqciyvidkfgldqegiyrksanvldvsklkeeidkdp
anismilpsphsdsdiylvgsllktffaslpdsvlpkalsseikvclqiedpttrknfmh
gliynlpdaqywtlralvfhlkrvlaheaqnrmnlralciiwgptiapanpddandvnfq
imamevllevsdqafepe

SCOPe Domain Coordinates for d4u3ka1:

Click to download the PDB-style file with coordinates for d4u3ka1.
(The format of our PDB-style files is described here.)

Timeline for d4u3ka1:

  • d4u3ka1 first appeared in SCOPe 2.05, called d4u3ka_

View in 3D
Domains from same chain:
(mouse over for more information)
d4u3ka2