Lineage for d4u3sa_ (4u3s A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377026Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2377050Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 2377051Protein Cellulosomal scaffoldin adaptor protein B, ScaB [110073] (1 species)
  7. 2377052Species Acetivibrio cellulolyticus [TaxId:35830] [110074] (8 PDB entries)
    Uniprot Q7WYN3 29-199
  8. 2377064Domain d4u3sa_: 4u3s A: [275443]
    Other proteins in same PDB: d4u3sb1, d4u3sb2
    automated match to d3fnkb_
    complexed with ca, nhe; mutant

Details for d4u3sa_

PDB Entry: 4u3s (more details), 1.64 Å

PDB Description: crystal structure of coh3scab-xdoc_m1scaa complex: a n-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus
PDB Compounds: (A:) Cellulosomal scaffoldin adaptor protein B

SCOPe Domain Sequences for d4u3sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u3sa_ b.2.2.2 (A:) Cellulosomal scaffoldin adaptor protein B, ScaB {Acetivibrio cellulolyticus [TaxId: 35830]}
esyitmnfdkntaevgqiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytnss
lptsgellvnedygpivqgvhkisegilnlsrsytaldvyrasespeetgtvavvgfkal
qkkattvvfehsvtmpngiigttlfnwygnritsgysviqpgeinse

SCOPe Domain Coordinates for d4u3sa_:

Click to download the PDB-style file with coordinates for d4u3sa_.
(The format of our PDB-style files is described here.)

Timeline for d4u3sa_: