Lineage for d1dima_ (1dim A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 807194Superfamily b.68.1: Sialidases [50939] (2 families) (S)
  5. 807195Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)
  6. 807322Protein Salmonella sialidase [50941] (1 species)
  7. 807323Species Salmonella typhimurium, strain lt2 [TaxId:90371] [50942] (5 PDB entries)
  8. 807326Domain d1dima_: 1dim A: [27544]
    complexed with eqp, k

Details for d1dima_

PDB Entry: 1dim (more details), 1.6 Å

PDB Description: sialidase from salmonella typhimurium complexed with epana inhibitor
PDB Compounds: (A:) sialidase

SCOP Domain Sequences for d1dima_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dima_ b.68.1.1 (A:) Salmonella sialidase {Salmonella typhimurium, strain lt2 [TaxId: 90371]}
tveksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntas
dqsfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkw
nnndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsg
lqlndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnasl
vnnirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaq
nknndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvye
angsiefqdlsrhlpviksyn

SCOP Domain Coordinates for d1dima_:

Click to download the PDB-style file with coordinates for d1dima_.
(The format of our PDB-style files is described here.)

Timeline for d1dima_: