Lineage for d1dim__ (1dim -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565371Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 565372Superfamily b.68.1: Sialidases [50939] (2 families) (S)
  5. 565373Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)
  6. 565487Protein Salmonella sialidase [50941] (1 species)
  7. 565488Species Salmonella typhimurium, strain lt2 [TaxId:90371] [50942] (5 PDB entries)
  8. 565491Domain d1dim__: 1dim - [27544]
    complexed with eqp, k

Details for d1dim__

PDB Entry: 1dim (more details), 1.6 Å

PDB Description: sialidase from salmonella typhimurium complexed with epana inhibitor

SCOP Domain Sequences for d1dim__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dim__ b.68.1.1 (-) Salmonella sialidase {Salmonella typhimurium, strain lt2}
tveksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntas
dqsfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkw
nnndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsg
lqlndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnasl
vnnirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaq
nknndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvye
angsiefqdlsrhlpviksyn

SCOP Domain Coordinates for d1dim__:

Click to download the PDB-style file with coordinates for d1dim__.
(The format of our PDB-style files is described here.)

Timeline for d1dim__: