SCOPe 2.06: Domain d4tz9a1: 4tz9 A:42-270

Lineage for d4tz9a1 (4tz9 A:42-270)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (18 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [226145] (7 PDB entries)

8. Domain d4tz9a1: 4tz9 A:42-270 [275433]
   Other proteins in same PDB: d4tz9a2
   automated match to d3zr9a_
   complexed with cd, co, ni, zn

Details for d4tz9a1

PDB Entry: 4tz9, 2.13 Å

PDB Description: structure of metallo-beta-lactamase

PDB Compounds: (A:) Class B metallo-beta-lactamase

SCOPe Domain Sequences for d4tz9a1:

Sequence; same for both SEQRES and ATOM records:

>d4tz9a1 d.157.1.0 (A:42-270) automated matches {Escherichia coli [TaxId: 562]}
gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtndqtaqi
lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsl
tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Timeline for d4tz9a1:

• d4tz9a1 first appeared in SCOPe 2.05, called d4tz9a_
  
• d4tz9a1 appears in SCOPe 2.07
  
• d4tz9a1 appears in the current release, SCOPe 2.08