Lineage for d2sil__ (2sil -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62715Fold b.68: 6-bladed beta-propeller [50938] (6 superfamilies)
  4. 62716Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 62717Family b.68.1.1: Sialidases (neuraminidases) [50940] (6 proteins)
  6. 62806Protein Salmonella sialidase [50941] (1 species)
  7. 62807Species Salmonella typhimurium, strain lt2 [TaxId:90371] [50942] (5 PDB entries)
  8. 62809Domain d2sil__: 2sil - [27543]

Details for d2sil__

PDB Entry: 2sil (more details), 1.6 Å

PDB Description: the structures of salmonella typhimurium lt2 neuraminidase and its complex with a transition state analogue at 1.6 angstroms resolution

SCOP Domain Sequences for d2sil__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sil__ b.68.1.1 (-) Salmonella sialidase {Salmonella typhimurium, strain lt2}
tveksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntas
dqsfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkw
nnndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsg
lqlndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnasl
vnnirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaq
nknndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvye
angsiefqdlsrhlpviksyn

SCOP Domain Coordinates for d2sil__:

Click to download the PDB-style file with coordinates for d2sil__.
(The format of our PDB-style files is described here.)

Timeline for d2sil__: