SCOPe 2.06: Domain d4tprl1: 4tpr L:1-112

Lineage for d4tprl1 (4tpr L:1-112)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)

8. Domain d4tprl1: 4tpr L:1-112 [275428]
   Other proteins in same PDB: d4tprl2
   automated match to d2ok0l1
   complexed with 33o, cl, na, peg, pg4, pge, trs

Details for d4tprl1

PDB Entry: 4tpr, 1.6 Å

PDB Description: structure of tau5 antibody fab fragment

PDB Compounds: (L:) If kappa light chain

SCOPe Domain Sequences for d4tprl1:

Sequence; same for both SEQRES and ATOM records:

>d4tprl1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleik

Timeline for d4tprl1:

• d4tprl1 first appeared in SCOPe 2.05
  
• d4tprl1 appears in SCOPe 2.07
  
• d4tprl1 appears in the current release, SCOPe 2.08