![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (22 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries) |
![]() | Domain d4tprl1: 4tpr L:1-112 [275428] Other proteins in same PDB: d4tprl2 automated match to d2ok0l1 complexed with 33o, cl, na, peg, pg4, pge, trs |
PDB Entry: 4tpr (more details), 1.6 Å
SCOPe Domain Sequences for d4tprl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tprl1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleik
Timeline for d4tprl1: