Lineage for d4rx0a_ (4rx0 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080389Protein automated matches [190228] (18 species)
    not a true protein
  7. 2080446Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [256645] (7 PDB entries)
  8. 2080451Domain d4rx0a_: 4rx0 A: [275427]
    automated match to d4cq8a_
    complexed with d65, fmn, gol, oro

Details for d4rx0a_

PDB Entry: 4rx0 (more details), 2.25 Å

PDB Description: crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with inhibitor dsm265
PDB Compounds: (A:) Dihydroorotate dehydrogenase (quinone), mitochondrial

SCOPe Domain Sequences for d4rx0a_:

Sequence, based on SEQRES records: (download)

>d4rx0a_ c.1.4.1 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ynpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldfinp
fgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscgfnn
mgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryadyia
invsspntpglrdnqeagklkniilsvkeeidnleknnimndeflwfnttkkkplvfvkl
apdlnqeqkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkfic
emynytnkqipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnhll
yqrgyynlkeaigrkh

Sequence, based on observed residues (ATOM records): (download)

>d4rx0a_ c.1.4.1 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ynpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldfinp
fgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscgfnn
mgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryadyia
invsspeagklkniilsvkeeidnleknnimndeflwfnttkkkplvfvklapdlnqeqk
keiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkficemynytnkq
ipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnhllyqrgyynlk
eaigrkh

SCOPe Domain Coordinates for d4rx0a_:

Click to download the PDB-style file with coordinates for d4rx0a_.
(The format of our PDB-style files is described here.)

Timeline for d4rx0a_: