SCOPe 2.08: Domain d4r7dp1: 4r7d P:2-106

Lineage for d4r7dp1 (4r7d P:2-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4r7dp1: 4r7d P:2-106 [275425]
   Other proteins in same PDB: d4r7da2, d4r7db2, d4r7dc2, d4r7dd2, d4r7de2, d4r7df2, d4r7dg2, d4r7dh2, d4r7di2, d4r7dj2, d4r7dk2, d4r7dl2, d4r7dm2, d4r7dn2, d4r7do2, d4r7dp2
   automated match to d1dn0a1

Details for d4r7dp1

PDB Entry: 4r7d, 2.75 Å

PDB Description: fab hu 15c1

PDB Compounds: (P:) Fab Hu 15C1 Light chain

SCOPe Domain Sequences for d4r7dp1:

Sequence; same for both SEQRES and ATOM records:

>d4r7dp1 b.1.1.0 (P:2-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvpsr
fsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkvei

Timeline for d4r7dp1:

• d4r7dp1 first appeared in SCOPe 2.05
  
• d4r7dp1 appears in SCOPe 2.07