Lineage for d4r7dp1 (4r7d P:2-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758914Domain d4r7dp1: 4r7d P:2-106 [275425]
    Other proteins in same PDB: d4r7da2, d4r7db2, d4r7dc2, d4r7dd2, d4r7de2, d4r7df2, d4r7dg2, d4r7dh2, d4r7di2, d4r7dj2, d4r7dk2, d4r7dl2, d4r7dm2, d4r7dn2, d4r7do2, d4r7dp2
    automated match to d1dn0a1

Details for d4r7dp1

PDB Entry: 4r7d (more details), 2.75 Å

PDB Description: fab hu 15c1
PDB Compounds: (P:) Fab Hu 15C1 Light chain

SCOPe Domain Sequences for d4r7dp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r7dp1 b.1.1.0 (P:2-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvpsr
fsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkvei

SCOPe Domain Coordinates for d4r7dp1:

Click to download the PDB-style file with coordinates for d4r7dp1.
(The format of our PDB-style files is described here.)

Timeline for d4r7dp1: