SCOPe 2.05: Domain d4rd6a1: 4rd6 A:2-206

Lineage for d4rd6a1 (4rd6 A:2-206)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (27 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [256083] (11 PDB entries)

8. Domain d4rd6a1: 4rd6 A:2-206 [275422]
   Other proteins in same PDB: d4rd6a2, d4rd6a3
   automated match to d2qn6a3
   complexed with gdp, mg

Details for d4rd6a1

PDB Entry: 4rd6, 1.94 Å

PDB Description: structure of aif2-gamma from sulfolobus solfataricus bound to gdp

PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4rd6a1:

Sequence, based on SEQRES records:

>d4rd6a1 c.37.1.8 (A:2-206) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

Sequence, based on observed residues (ATOM records):

>d4rd6a1 c.37.1.8 (A:2-206) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhsklgyaetnigvcesckkpeayvt
epsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtr
ehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkin
idsliegieeyiktpy

Timeline for d4rd6a1:

• d4rd6a1 is new in SCOPe 2.05-stable
  
• d4rd6a1 appears in SCOPe 2.06
  
• d4rd6a1 appears in the current release, SCOPe 2.07