![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein automated matches [190047] (27 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:273057] [256083] (11 PDB entries) |
![]() | Domain d4rd6a1: 4rd6 A:2-206 [275422] Other proteins in same PDB: d4rd6a2, d4rd6a3 automated match to d2qn6a3 complexed with gdp, mg |
PDB Entry: 4rd6 (more details), 1.94 Å
SCOPe Domain Sequences for d4rd6a1:
Sequence, based on SEQRES records: (download)
>d4rd6a1 c.37.1.8 (A:2-206) automated matches {Sulfolobus solfataricus [TaxId: 273057]} awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii pvsalhkinidsliegieeyiktpy
>d4rd6a1 c.37.1.8 (A:2-206) automated matches {Sulfolobus solfataricus [TaxId: 273057]} awpkvqpevnigvvghvdhgkttlvqaitgiwtskhsklgyaetnigvcesckkpeayvt epsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtr ehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkin idsliegieeyiktpy
Timeline for d4rd6a1: