| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d4r7dj2: 4r7d J:107-212 [275421] Other proteins in same PDB: d4r7da1, d4r7da2, d4r7db1, d4r7dc1, d4r7dc2, d4r7dd1, d4r7de1, d4r7de2, d4r7df1, d4r7dg1, d4r7dg2, d4r7dh1, d4r7di1, d4r7di2, d4r7dj1, d4r7dk1, d4r7dk2, d4r7dl1, d4r7dm1, d4r7dm2, d4r7dn1, d4r7do1, d4r7do2, d4r7dp1 automated match to d1dn0a2 |
PDB Entry: 4r7d (more details), 2.75 Å
SCOPe Domain Sequences for d4r7dj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r7dj2 b.1.1.2 (J:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d4r7dj2:
View in 3DDomains from other chains: (mouse over for more information) d4r7da1, d4r7da2, d4r7db1, d4r7db2, d4r7dc1, d4r7dc2, d4r7dd1, d4r7dd2, d4r7de1, d4r7de2, d4r7df1, d4r7df2, d4r7dg1, d4r7dg2, d4r7dh1, d4r7dh2, d4r7di1, d4r7di2, d4r7dk1, d4r7dk2, d4r7dl1, d4r7dl2, d4r7dm1, d4r7dm2, d4r7dn1, d4r7dn2, d4r7do1, d4r7do2, d4r7dp1, d4r7dp2 |