Lineage for d3sil__ (3sil -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17044Fold b.68: 6-bladed beta-propeller [50938] (4 superfamilies)
  4. 17045Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 17046Family b.68.1.1: Sialidases (neuraminidases) [50940] (5 proteins)
  6. 17123Protein Salmonella sialidase [50941] (1 species)
  7. 17124Species Salmonella typhimurium, strain lt2 [TaxId:90371] [50942] (5 PDB entries)
  8. 17125Domain d3sil__: 3sil - [27542]

Details for d3sil__

PDB Entry: 3sil (more details), 1.05 Å

PDB Description: sialidase from salmonella typhimurium

SCOP Domain Sequences for d3sil__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sil__ b.68.1.1 (-) Salmonella sialidase {Salmonella typhimurium, strain lt2}
eksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntasdq
sfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkwnn
ndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsglq
lndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnaslvn
nirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaqnk
nndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvyean
gsiefqdlsrhlpviksyn

SCOP Domain Coordinates for d3sil__:

Click to download the PDB-style file with coordinates for d3sil__.
(The format of our PDB-style files is described here.)

Timeline for d3sil__: