Lineage for d3sila_ (3sil A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398195Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2398427Protein Salmonella sialidase [50941] (1 species)
  7. 2398428Species Salmonella typhimurium, strain lt2 [TaxId:90371] [50942] (5 PDB entries)
  8. 2398429Domain d3sila_: 3sil A: [27542]
    complexed with gol, k, po4

Details for d3sila_

PDB Entry: 3sil (more details), 1.05 Å

PDB Description: sialidase from salmonella typhimurium
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d3sila_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sila_ b.68.1.1 (A:) Salmonella sialidase {Salmonella typhimurium, strain lt2 [TaxId: 90371]}
eksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntasdq
sfidtaaarstdggktwnkkiaiyndrvnsklsrvmdptcivaniqgretilvmvgkwnn
ndktwgayrdkapdtdwdlvlykstddgvtfskvetnihdivtkngtisamlggvgsglq
lndgklvfpvqmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnaslvn
nirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaqnk
nndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvyean
gsiefqdlsrhlpviksyn

SCOPe Domain Coordinates for d3sila_:

Click to download the PDB-style file with coordinates for d3sila_.
(The format of our PDB-style files is described here.)

Timeline for d3sila_: