| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d4r7dl1: 4r7d L:1-106 [275416] Other proteins in same PDB: d4r7da2, d4r7db2, d4r7dc2, d4r7dd2, d4r7de2, d4r7df2, d4r7dg2, d4r7dh2, d4r7di2, d4r7dj2, d4r7dk2, d4r7dl2, d4r7dm2, d4r7dn2, d4r7do2, d4r7dp2 automated match to d1dn0a1 |
PDB Entry: 4r7d (more details), 2.75 Å
SCOPe Domain Sequences for d4r7dl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r7dl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspdfqsvtpkekvtitcrasqsisdhlhwyqqkpdqspkllikyashaisgvps
rfsgsgsgtdftltinsleaedaatyycqqghsfpltfgggtkvei
Timeline for d4r7dl1:
View in 3DDomains from other chains: (mouse over for more information) d4r7da1, d4r7da2, d4r7db1, d4r7db2, d4r7dc1, d4r7dc2, d4r7dd1, d4r7dd2, d4r7de1, d4r7de2, d4r7df1, d4r7df2, d4r7dg1, d4r7dg2, d4r7dh1, d4r7dh2, d4r7di1, d4r7di2, d4r7dj1, d4r7dj2, d4r7dk1, d4r7dk2, d4r7dm1, d4r7dm2, d4r7dn1, d4r7dn2, d4r7do1, d4r7do2, d4r7dp1, d4r7dp2 |