SCOPe 2.08: Domain d4r7dh2: 4r7d H:107-212

Lineage for d4r7dh2 (4r7d H:107-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4r7dh2: 4r7d H:107-212 [275415]
   Other proteins in same PDB: d4r7da1, d4r7da2, d4r7db1, d4r7dc1, d4r7dc2, d4r7dd1, d4r7de1, d4r7de2, d4r7df1, d4r7dg1, d4r7dg2, d4r7dh1, d4r7di1, d4r7di2, d4r7dj1, d4r7dk1, d4r7dk2, d4r7dl1, d4r7dm1, d4r7dm2, d4r7dn1, d4r7do1, d4r7do2, d4r7dp1
   automated match to d1dn0a2

Details for d4r7dh2

PDB Entry: 4r7d, 2.75 Å

PDB Description: fab hu 15c1

PDB Compounds: (H:) Fab Hu 15C1 Light chain

SCOPe Domain Sequences for d4r7dh2:

Sequence; same for both SEQRES and ATOM records:

>d4r7dh2 b.1.1.2 (H:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d4r7dh2:

• d4r7dh2 first appeared in SCOPe 2.05
  
• d4r7dh2 appears in SCOPe 2.07