Lineage for d1tl2a_ (1tl2 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807321Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2807322Superfamily b.67.1: Tachylectin-2 [50934] (2 families) (S)
  5. 2807323Family b.67.1.1: Tachylectin-2 [50935] (1 protein)
  6. 2807324Protein Tachylectin-2 [50936] (1 species)
  7. 2807325Species Japanese horseshoe crab (Tachypleus tridentatus) [TaxId:6853] [50937] (1 PDB entry)
  8. 2807326Domain d1tl2a_: 1tl2 A: [27541]
    complexed with ndg

Details for d1tl2a_

PDB Entry: 1tl2 (more details), 2 Å

PDB Description: tachylectin-2 from tachypleus tridentatus (japanese horseshoe crab)
PDB Compounds: (A:) protein (tachylectin-2)

SCOPe Domain Sequences for d1tl2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tl2a_ b.67.1.1 (A:) Tachylectin-2 {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]}
ggesmlrgvyqdkfyqgtypqnkndnwlaratligkggwsnfkflflspggelygvlndk
iykgtppthdndnwmgrakkignggwnqfqflffdpngylyavskdklykasppqsdtdn
wiaratevgsggwsgfkflffhpngylyavhgqqfykalppvsnqdnwlaratkigqggw
dtfkflffssvgtlfgvqggkfyedyppsyaydnwlaraklignggwddfrflff

SCOPe Domain Coordinates for d1tl2a_:

Click to download the PDB-style file with coordinates for d1tl2a_.
(The format of our PDB-style files is described here.)

Timeline for d1tl2a_: