Class b: All beta proteins [48724] (180 folds) |
Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
Superfamily b.67.1: Tachylectin-2 [50934] (2 families) |
Family b.67.1.1: Tachylectin-2 [50935] (1 protein) |
Protein Tachylectin-2 [50936] (1 species) |
Species Japanese horseshoe crab (Tachypleus tridentatus) [TaxId:6853] [50937] (1 PDB entry) |
Domain d1tl2a_: 1tl2 A: [27541] complexed with ndg |
PDB Entry: 1tl2 (more details), 2 Å
SCOPe Domain Sequences for d1tl2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tl2a_ b.67.1.1 (A:) Tachylectin-2 {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} ggesmlrgvyqdkfyqgtypqnkndnwlaratligkggwsnfkflflspggelygvlndk iykgtppthdndnwmgrakkignggwnqfqflffdpngylyavskdklykasppqsdtdn wiaratevgsggwsgfkflffhpngylyavhgqqfykalppvsnqdnwlaratkigqggw dtfkflffssvgtlfgvqggkfyedyppsyaydnwlaraklignggwddfrflff
Timeline for d1tl2a_: