Lineage for d4r7db2 (4r7d B:107-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752071Domain d4r7db2: 4r7d B:107-211 [275409]
    Other proteins in same PDB: d4r7da1, d4r7da2, d4r7db1, d4r7dc1, d4r7dc2, d4r7dd1, d4r7de1, d4r7de2, d4r7df1, d4r7dg1, d4r7dg2, d4r7dh1, d4r7di1, d4r7di2, d4r7dj1, d4r7dk1, d4r7dk2, d4r7dl1, d4r7dm1, d4r7dm2, d4r7dn1, d4r7do1, d4r7do2, d4r7dp1
    automated match to d1dn0a2

Details for d4r7db2

PDB Entry: 4r7d (more details), 2.75 Å

PDB Description: fab hu 15c1
PDB Compounds: (B:) Fab Hu 15C1 Light chain

SCOPe Domain Sequences for d4r7db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r7db2 b.1.1.2 (B:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d4r7db2:

Click to download the PDB-style file with coordinates for d4r7db2.
(The format of our PDB-style files is described here.)

Timeline for d4r7db2: