SCOPe 2.06: Domain d1pexa_: 1pex A:

Lineage for d1pexa_ (1pex A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
   consists of four 4-stranded beta-sheet motifs; meander

4. Superfamily b.66.1: Hemopexin-like domain [50923] (2 families)

5. Family b.66.1.1: Hemopexin-like domain [50924] (6 proteins)

6. Protein Collagenase-3 (MMP-13), C-terminal domain [50931] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50932] (1 PDB entry)

8. Domain d1pexa_: 1pex A: [27540]
   complexed with ca, cl, so4

Details for d1pexa_

PDB Entry: 1pex, 2.7 Å

PDB Description: collagenase-3 (mmp-13) c-terminal hemopexin-like domain

PDB Compounds: (A:) collagenase-3

SCOPe Domain Sequences for d1pexa_:

Sequence; same for both SEQRES and ATOM records:

>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tpdkcdpslsldaitslrgetmifkdrffwrlhpqqvdaelfltksfwpelpnridaaye
hpshdlififrgrkfwalngydilegypkkiselglpkevkkisaavhfedtgktllfsg
nqvwryddtnhimdkdyprlieedfpgigdkvdavyekngyiyffngpiqfeysiwsnri
vrvmpansilwc

Timeline for d1pexa_:

• d1pexa_ first appeared (with stable ids) in SCOP 1.55, called d1pex__
  
• d1pexa_ appears in SCOPe 2.05
  
• d1pexa_ appears in SCOPe 2.07
  
• d1pexa_ appears in the current release, SCOPe 2.08