SCOPe 2.03: Domain d1fbla1: 1fbl A:272-466

Lineage for d1fbla1 (1fbl A:272-466)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
   consists of four 4-stranded beta-sheet motifs; meander

4. Superfamily b.66.1: Hemopexin-like domain [50923] (2 families)

5. Family b.66.1.1: Hemopexin-like domain [50924] (6 proteins)

6. Protein Collagenase (MMP1), C-terminal domain [50929] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50930] (1 PDB entry)

8. Domain d1fbla1: 1fbl A:272-466 [27539]
   Other proteins in same PDB: d1fbla2
   complexed with ca, hta, zn

Details for d1fbla1

PDB Entry: 1fbl, 2.5 Å

PDB Description: structure of full-length porcine synovial collagenase (mmp1) reveals a c-terminal domain containing a calcium-linked, four-bladed beta-propeller

PDB Compounds: (A:) fibroblast (interstitial) collagenase (mmp-1)

SCOPe Domain Sequences for d1fbla1:

Sequence; same for both SEQRES and ATOM records:

>d1fbla1 b.66.1.1 (A:272-466) Collagenase (MMP1), C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
pqtpqvcdskltfdaittlrgelmffkdrfymrtnsfypevelnfisvfwpqvpnglqaa
yeiadrdevrffkgnkywavrgqdvlygypkdihrsfgfpstvknidaavfeedtgktyf
fvahecwrydeykqsmdtgypkmiaeefpgignkvdavfqkdgflyffhgtrqyqfdfkt
kriltlqkanswfnc

Timeline for d1fbla1:

• d1fbla1 first appeared (with stable ids) in SCOP 1.55, called d1fbl_1
  
• d1fbla1 appears in SCOPe 2.02
  
• d1fbla1 appears in SCOPe 2.04
  
• d1fbla1 appears in the current release, SCOPe 2.08