SCOP 1.71: Domain d1fbl_1: 1fbl 272-466

Lineage for d1fbl_1 (1fbl 272-466)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
   consists of four 4-stranded beta-sheet motifs; meander

4. Superfamily b.66.1: Hemopexin-like domain [50923] (1 family)

5. Family b.66.1.1: Hemopexin-like domain [50924] (5 proteins)

6. Protein Collagenase (MMP1), C-terminal domain [50929] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50930] (1 PDB entry)

8. Domain d1fbl_1: 1fbl 272-466 [27539]
   Other proteins in same PDB: d1fbl_2
   complexed with ca, hta, zn

Details for d1fbl_1

PDB Entry: 1fbl, 2.5 Å

PDB Description: structure of full-length porcine synovial collagenase (mmp1) reveals a c-terminal domain containing a calcium-linked, four-bladed beta-propeller

SCOP Domain Sequences for d1fbl_1:

Sequence; same for both SEQRES and ATOM records:

>d1fbl_1 b.66.1.1 (272-466) Collagenase (MMP1), C-terminal domain {Pig (Sus scrofa)}
pqtpqvcdskltfdaittlrgelmffkdrfymrtnsfypevelnfisvfwpqvpnglqaa
yeiadrdevrffkgnkywavrgqdvlygypkdihrsfgfpstvknidaavfeedtgktyf
fvahecwrydeykqsmdtgypkmiaeefpgignkvdavfqkdgflyffhgtrqyqfdfkt
kriltlqkanswfnc

Timeline for d1fbl_1:

• d1fbl_1 first appeared (with stable ids) in SCOP 1.55
  
• d1fbl_1 appears in SCOP 1.69
  
• d1fbl_1 is called d1fbla1 in SCOP 1.73
  
• d1fbl_1 appears in the current release, SCOPe 2.08, called d1fbla1