Lineage for d1fbl_1 (1fbl 272-466)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17015Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
  4. 17016Superfamily b.66.1: Hemopexin-like domain [50923] (1 family) (S)
  5. 17017Family b.66.1.1: Hemopexin-like domain [50924] (4 proteins)
  6. 17018Protein Collagenase, C-terminal domain [50929] (1 species)
  7. 17019Species Pig (Sus scrofa) [TaxId:9823] [50930] (1 PDB entry)
  8. 17020Domain d1fbl_1: 1fbl 272-466 [27539]
    Other proteins in same PDB: d1fbl_2

Details for d1fbl_1

PDB Entry: 1fbl (more details), 2.5 Å

PDB Description: structure of full-length porcine synovial collagenase (mmp1) reveals a c-terminal domain containing a calcium-linked, four-bladed beta-propeller

SCOP Domain Sequences for d1fbl_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbl_1 b.66.1.1 (272-466) Collagenase, C-terminal domain {Pig (Sus scrofa)}
pqtpqvcdskltfdaittlrgelmffkdrfymrtnsfypevelnfisvfwpqvpnglqaa
yeiadrdevrffkgnkywavrgqdvlygypkdihrsfgfpstvknidaavfeedtgktyf
fvahecwrydeykqsmdtgypkmiaeefpgignkvdavfqkdgflyffhgtrqyqfdfkt
kriltlqkanswfnc

SCOP Domain Coordinates for d1fbl_1:

Click to download the PDB-style file with coordinates for d1fbl_1.
(The format of our PDB-style files is described here.)

Timeline for d1fbl_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fbl_2