Lineage for d1ck7a1 (1ck7 A:461-660)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565285Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 565286Superfamily b.66.1: Hemopexin-like domain [50923] (1 family) (S)
  5. 565287Family b.66.1.1: Hemopexin-like domain [50924] (5 proteins)
  6. 565297Protein Gelatinase A (MMP-2), C-terminal domain [50927] (1 species)
  7. 565298Species Human (Homo sapiens) [TaxId:9606] [50928] (4 PDB entries)
  8. 565301Domain d1ck7a1: 1ck7 A:461-660 [27538]
    Other proteins in same PDB: d1ck7a3, d1ck7a4, d1ck7a5, d1ck7a6, d1ck7a7
    complexed with ca, cl, na, so4, zn; mutant

Details for d1ck7a1

PDB Entry: 1ck7 (more details), 2.8 Å

PDB Description: gelatinase a (full-length)

SCOP Domain Sequences for d1ck7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ck7a1 b.66.1.1 (A:461-660) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens)}
lgpvtpeickqdivfdgiaqirgeifffkdrfiwrtvtprdkpmgpllvatfwpelpeki
davyeapqeekavffagneywiysastlergypkpltslglppdvqrvdaafnwsknkkt
yifagdkfwrynevkkkmdpgfpkliadawnaipdnldavvdlqggghsyffkgayylkl
enqslksvkfgsiksdwlgc

SCOP Domain Coordinates for d1ck7a1:

Click to download the PDB-style file with coordinates for d1ck7a1.
(The format of our PDB-style files is described here.)

Timeline for d1ck7a1: