| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.5: Hemolysin expression modulating protein HHA [68989] (2 families) ![]() automatically mapped to Pfam PF05321 |
| Family a.23.5.1: Hemolysin expression modulating protein HHA [68990] (2 proteins) |
| Protein Hemolysin expression modulating protein HHA [68991] (2 species) |
| Species Escherichia coli [TaxId:83333] [275376] (1 PDB entry) |
| Domain d2mw2a_: 2mw2 A: [275377] automated match to d1jw2a_ protein/DNA complex |
PDB Entry: 2mw2 (more details)
SCOPe Domain Sequences for d2mw2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mw2a_ a.23.5.1 (A:) Hemolysin expression modulating protein HHA {Escherichia coli [TaxId: 83333]}
ltktdylmrlrrcqtidtlervieknkyelsdnelavfysaadhrlaeltmnklydkips
svwkfir
Timeline for d2mw2a_: