Lineage for d1rtga_ (1rtg A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807050Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 807051Superfamily b.66.1: Hemopexin-like domain [50923] (1 family) (S)
  5. 807052Family b.66.1.1: Hemopexin-like domain [50924] (5 proteins)
  6. 807064Protein Gelatinase A (MMP-2), C-terminal domain [50927] (1 species)
  7. 807065Species Human (Homo sapiens) [TaxId:9606] [50928] (4 PDB entries)
  8. 807067Domain d1rtga_: 1rtg A: [27537]
    complexed with ca, cl

Details for d1rtga_

PDB Entry: 1rtg (more details), 2.6 Å

PDB Description: c-terminal domain (haemopexin-like domain) of human matrix metalloproteinase-2
PDB Compounds: (A:) human gelatinase a

SCOP Domain Sequences for d1rtga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtga_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tptlgpvtpeickqdivfdgiaqirgeifffkdrfiwrtvtprdkpmgpllvatfwpelp
ekidavyeapqeekavffagneywiysastlergypkpltslglppdvqrvdaafnwskn
kktyifagdkfwrynevkkkmdpgfpkliadawnaipdnldavvdlqggghsyffkgayy
lklenqslksvkfgsiksdwlgc

SCOP Domain Coordinates for d1rtga_:

Click to download the PDB-style file with coordinates for d1rtga_.
(The format of our PDB-style files is described here.)

Timeline for d1rtga_: