SCOPe 2.05: Domain d5cjja_: 5cjj A:

Lineage for d5cjja_ (5cjj A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.0: automated matches [191608] (1 protein)
   not a true family

6. Protein automated matches [191110] (9 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [275366] (1 PDB entry)

8. Domain d5cjja_: 5cjj A: [275368]
   automated match to d3p9xb_
   complexed with cl, gol, peg, so4

Details for d5cjja_

PDB Entry: 5cjj, 2.42 Å

PDB Description: the crystal structure of phosphoribosylglycinamide formyltransferase from campylobacter jejuni subsp. jejuni nctc 11168

PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d5cjja_:

Sequence, based on SEQRES records:

>d5cjja_ c.65.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
namlvklavlfsgngsnlenileklhkktigentyeivlclcnkkdafgiqrakkfglnt
viidhkayntreefdtilvqkikesganltvlagfmrilspvftknikainlhpsllplf
kgahaikesyesdmkvagvsvhwvseeldggmiiaqkafekrnlsfeefeekihslehei
lplsvieifs

Sequence, based on observed residues (ATOM records):

>d5cjja_ c.65.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
namlvklavlfsgngsnlenileklhkktigentyeivlclcnkkdafgiqrakkfglnt
vikayntreefdtilvqkikesganltvlagfmrilspvftknikainlhpsllplfkga
haikesyesdmkvagvsvhwvseeldggmiiaqkafekrnlsfeefeekihsleheilpl
svieifs

Timeline for d5cjja_:

• d5cjja_ is new in SCOPe 2.05-stable
  
• d5cjja_ is called d5cjja1 in SCOPe 2.06
  
• d5cjja_ appears in the current release, SCOPe 2.08, called d5cjja1