SCOPe 2.08: Domain d5cjjb1: 5cjj B:1-188

Lineage for d5cjjb1 (5cjj B:1-188)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.0: automated matches [191608] (1 protein)
   not a true family

6. Protein automated matches [191110] (11 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [275366] (1 PDB entry)

8. Domain d5cjjb1: 5cjj B:1-188 [275367]
   Other proteins in same PDB: d5cjja2, d5cjjb2
   automated match to d3p9xb_
   complexed with cl, gol, peg, so4

Details for d5cjjb1

PDB Entry: 5cjj, 2.42 Å

PDB Description: the crystal structure of phosphoribosylglycinamide formyltransferase from campylobacter jejuni subsp. jejuni nctc 11168

PDB Compounds: (B:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d5cjjb1:

Sequence; same for both SEQRES and ATOM records:

>d5cjjb1 c.65.1.0 (B:1-188) automated matches {Campylobacter jejuni [TaxId: 192222]}
mlvklavlfsgngsnlenileklhkktigentyeivlclcnkkdafgiqrakkfglntvi
idhkayntreefdtilvqkikesganltvlagfmrilspvftknikainlhpsllplfkg
ahaikesyesdmkvagvsvhwvseeldggmiiaqkafekrnlsfeefeekihsleheilp
lsvieifs

Timeline for d5cjjb1:

• d5cjjb1 first appeared in SCOPe 2.05, called d5cjjb_
  
• d5cjjb1 appears in SCOPe 2.07