SCOPe 2.05: Domain d5c24a2: 5c24 A:430-545

Lineage for d5c24a2 (5c24 A:430-545)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (30 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (2 PDB entries)

8. Domain d5c24a2: 5c24 A:430-545 [275363]
   Other proteins in same PDB: d5c24a1, d5c24b_
   automated match to d4puoa2
   complexed with 4xo, mg, so4

Details for d5c24a2

PDB Entry: 5c24, 2.6 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 7- ((4-((4-cyanophenyl)amino)-1,3,5-triazin-2-yl)amino)-6,8- dimethylindolizine-2-carbonitrile (jlj605), a non-nucleoside inhibitor

PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d5c24a2:

Sequence; same for both SEQRES and ATOM records:

>d5c24a2 c.55.3.0 (A:430-545) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggn

Timeline for d5c24a2:

• d5c24a2 is new in SCOPe 2.05-stable
  
• d5c24a2 appears in SCOPe 2.06
  
• d5c24a2 appears in the current release, SCOPe 2.08