Lineage for d5bt9a_ (5bt9 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830842Species Brucella ovis [TaxId:1293916] [275354] (1 PDB entry)
  8. 1830843Domain d5bt9a_: 5bt9 A: [275358]
    automated match to d4npcb_
    complexed with nap

Details for d5bt9a_

PDB Entry: 5bt9 (more details), 1.5 Å

PDB Description: crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with nadp
PDB Compounds: (A:) Uncharacterized protein BrcaA.00010.a

SCOPe Domain Sequences for d5bt9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bt9a_ c.2.1.0 (A:) automated matches {Brucella ovis [TaxId: 1293916]}
earmvancpvlvtggarrigkaivedlashgfpvaihcnrsldegeaianrindsggnac
vvqadlegdvrglvkqasdrigpirllvnnaslfqedkvgaldmalwdrhfavhlktpvi
laedmrkalpedqdglvvniidqrvwklnpqffsytlsktalwnatrtlaqalaprirvn
aiapgptlpserqrpedferqvsklplqrapelpefgrtvryfwenrsitgqmialdggq
hlawetpdi

SCOPe Domain Coordinates for d5bt9a_:

Click to download the PDB-style file with coordinates for d5bt9a_.
(The format of our PDB-style files is described here.)

Timeline for d5bt9a_: