SCOPe 2.08: Domain d1qjsb2: 1qjs B:223-435

Lineage for d1qjsb2 (1qjs B:223-435)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
   consists of four 4-stranded beta-sheet motifs; meander

4. Superfamily b.66.1: Hemopexin-like domain [50923] (2 families)

5. Family b.66.1.1: Hemopexin-like domain [50924] (6 proteins)

6. Protein Hemopexin [50925] (1 species)
   duplication: consists of two domains of this fold

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50926] (3 PDB entries)

8. Domain d1qjsb2: 1qjs B:223-435 [27535]
   complexed with cl, hem, na, po4

Details for d1qjsb2

PDB Entry: 1qjs, 2.9 Å

PDB Description: mammalian blood serum haemopexin glycosylated-native protein and in complex with its ligand haem

PDB Compounds: (B:) hemopexin

SCOPe Domain Sequences for d1qjsb2:

Sequence; same for both SEQRES and ATOM records:

>d1qjsb2 b.66.1.1 (B:223-435) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
hghestrcdpdlvlsamvsdnhgatyvfsgshywrldtnrdgwhswpiahqwpqgpstvd
aafswedklyliqdtkvyvfltkggytlvngypkrlekelgsppvisleavdaafvcpgs
srlhimagrrlwwldlksgaqatwtelpwphekvdgalcmekplgpnscstsgpnlylih
gpnlycyrhvdklnaaknlpqpqrvsrllgcth

Timeline for d1qjsb2:

• d1qjsb2 first appeared (with stable ids) in SCOP 1.55
  
• d1qjsb2 appears in SCOPe 2.07