Lineage for d1qjsb1 (1qjs B:24-218)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1801953Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 1801954Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) (S)
  5. 1801955Family b.66.1.1: Hemopexin-like domain [50924] (6 proteins)
  6. 1801976Protein Hemopexin [50925] (1 species)
    duplication: consists of two domains of this fold
  7. 1801977Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50926] (3 PDB entries)
  8. 1801983Domain d1qjsb1: 1qjs B:24-218 [27534]
    complexed with cl, hem, na, po4

Details for d1qjsb1

PDB Entry: 1qjs (more details), 2.9 Å

PDB Description: mammalian blood serum haemopexin glycosylated-native protein and in complex with its ligand haem
PDB Compounds: (B:) hemopexin

SCOPe Domain Sequences for d1qjsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjsb1 b.66.1.1 (B:24-218) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ieqcsdgwsfdattlddngtmlffkdefvwkshrgireliserwknfigpvdaafrhght
svylikgdkvwvytseknekvypkslqdefpgipfpldaavechrgecqdegilffqgnr
kwfwdlttgtkkerswpavgnctsalrwlgryycfqgnqflrfnpvsgevppgypldvrd
yflscpgrghrsshr

SCOPe Domain Coordinates for d1qjsb1:

Click to download the PDB-style file with coordinates for d1qjsb1.
(The format of our PDB-style files is described here.)

Timeline for d1qjsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qjsb2