Lineage for d5a0uc_ (5a0u C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097778Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2097779Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2097868Family c.7.1.0: automated matches [275322] (1 protein)
    not a true family
  6. 2097869Protein automated matches [275324] (2 species)
    not a true protein
  7. 2097870Species Klebsiella pneumoniae [TaxId:573] [275326] (2 PDB entries)
  8. 2097873Domain d5a0uc_: 5a0u C: [275338]
    automated match to d1r9da_
    complexed with cht

Details for d5a0uc_

PDB Entry: 5a0u (more details), 2.4 Å

PDB Description: structure of cutc choline lyase choline bound form from klebsiella pneumoniae.
PDB Compounds: (C:) choline trimethylamine lyase

SCOPe Domain Sequences for d5a0uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a0uc_ c.7.1.0 (C:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
vmegltprmqrlrnhyltvrpsvsiyralaftevvkanpgmptillrakafrhacetapi
liqddelivghpcgkpragafspdiawrwvrdeldtmstrpqdpfeiseadkktireeiv
pfwegrsldeiceaqyreagvwafsgetfvsdlsyhqingggdtcpgydvllftkgmngi
kadaeahlaslsmenpedidriyyykaaietcegvvnyarriaaharelaakeqnaqrra
elltiaevnenvpanppktlqealqsiwtveslfeieenqtglslgrvdqycypmfeadi
regrlthdtalellqafiikcaelmwmsselgakyfagyqpfinltvggqkrsggdacnd
ltylimdavrfvkvyqpslacrihnqspqkymekivdvvkagmgfpachfddshikmmlr
kgfdfedardyclmgcvepqksgriyqwtstgytqwpiaiefvlnrgrmvlfdsyqgldt
gdlrdlrtfdefdaavkqqiahivrlsaigtvisqrvhrdvapkplmsllvegcmesgkd
vaaggamvnhgpglifsglatyvdsmaairklvfeekkytleqirdallanfegyealrr
dclnapkygnddnyvdqyalditewtekecrkykmlystlshgtlsisnntpigeltnat
pngrlawmplsdgisptqgadkqgptaiiksvskmnvetmnigmvhnfkflkglldtpeg
rhglitllrtasilgngqmqfsyvdnevlkkaqqepekyrdlivrvagysayfvelckev
qdeiisrtviekf

SCOPe Domain Coordinates for d5a0uc_:

Click to download the PDB-style file with coordinates for d5a0uc_.
(The format of our PDB-style files is described here.)

Timeline for d5a0uc_: